PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000403.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 358aa    MW: 39447.4 Da    PI: 8.1065
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000403.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.3e-56201471128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL kkv ++++++ ++i+evd++k+ePw+Lp+k++ +ekewyfFs rd+ky+tg r+nrat++gyWkat
  Itr_sc000403.1_g00012.1  20 LPPGFRFHPTDEELITYYLLKKVVDSTFSA-RAIAEVDLNKCEPWELPEKARMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKAT 104
                              79**************************99.89***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkd+e++s+ + +lvg+kktLvfy+grapkgekt+Wvmheyrl
  Itr_sc000403.1_g00012.1 105 GKDREIYSSkTCALVGMKKTLVFYRGRAPKGEKTNWVMHEYRL 147
                              *******9745567***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-6415172IPR003441NAC domain
PROSITE profilePS5100560.28720172IPR003441NAC domain
PfamPF023657.6E-2921147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MDAFISYQQR FDCGGGDANL PPGFRFHPTD EELITYYLLK KVVDSTFSAR AIAEVDLNKC  60
EPWELPEKAR MGEKEWYFFS LRDRKYPTGL RTNRATEAGY WKATGKDREI YSSKTCALVG  120
MKKTLVFYRG RAPKGEKTNW VMHEYRLDGK FAYHYFSRAS KDEWVISRVF QKSGAAAAGG  180
GKRKMSSINL YPEVSSPSSV SLPPLVESSS YNNTATSALA IENESCSYDG VHTATKEHVP  240
CFSTAAPQTF TPNASLFDLP APPLTAAPNF SPLIDPSSAA SSNRFARNNN VGVPAFPSLR  300
SLQENLHLPF FFPGATPPPM HGGLGDQMGG YGSAIPGWAP ATESQKVGSS ELDCMWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-531917616169NO APICAL MERISTEM PROTEIN
1ut4_B5e-531917616169NO APICAL MERISTEM PROTEIN
1ut7_A5e-531917616169NO APICAL MERISTEM PROTEIN
1ut7_B5e-531917616169NO APICAL MERISTEM PROTEIN
4dul_A5e-531917616169NAC domain-containing protein 19
4dul_B5e-531917616169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615029.11e-163PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040171e-115NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLB8XS011e-155B8XS01_SOLLC; Goblet
STRINGSolyc07g062840.2.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-108NAC family protein